Hi i am trying to search through a file for a specific list of words. If one of those words if found i want to add a newline underneath and add this phrase \colour = 1 (I don't want to remove the orginal word i am searching for).
An extract of the file for context and format: LOCUS contig_2_pilon_pilon 5558986 bp DNA linear BCT 16-JUN-2020 DEFINITION Escherichia coli O157:H7 strain (270078) ACCESSION VERSION KEYWORDS . SOURCE Escherichia coli 270078 ORGANISM Escherichia coli 270078 Bacteria; Proteobacteria; gamma subdivision; Enterobacteriaceae; Escherichia. COMMENT Annotated using prokka 1.14.6 from https://github.com/tseemann/prokka. FEATURES Location/Qualifiers source 1..5558986 /organism="Escherichia coli 270078" /mol_type="genomic DNA" /strain="strain" /db_xref="taxon:562" CDS 61523..61744 /gene="pspD" /locus_tag="JCCJNNLA_00057" /inference="ab initio prediction:Prodigal:002006" /inference="similar to AA sequence:RefSeq:EG10779-MONOMER" /codon_start=1 /transl_table=11 /product="peripheral inner membrane heat-shock protein" /translation="MNTRWQQAGQKVKPGFKLAGKLVLLTALRYGPAGVAGWAIKSVA RRPLKMLLAVALEPLLSRAANKLAQRYKR"
Here is one of the lists of words i am looking for throughout the file:
regulation_list=["anti-repressor","anti-termination","antirepressor","antitermination","antiterminator","anti-terminator","cold-shock","cold shock","heat-shock","heat shock","regulation","regulator","regulatory","helicase","antibiotic resistance","repressor","zinc","sensor","dipeptidase","deacetylase","5-dehydrogenase","glucosamine kinase","glucosamine-kinase","dna-binding","dna binding","methylase","sulfurtransferase","acetyltransferase","control","ATP-binding","ATP binding","Cro","Ren protein","CII","inhibitor","activator","derepression","protein Sxy","sensing","sensor","Tir chaperone","Tir-cytoskeleton","Tir cytoskeleton","Tir protein","EspD"]
As you can see that extract contains one of th ephrases i am looking for and i want to add a newline underneath with the phrase /colour = 1
Any help would be great!
Prints:
You may want to add an extra newline and extra blanks to your
/colour=1string for alignment (it was not clear from you question), like so :